Lineage for d4oddb_ (4odd B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805580Species Canis lupus [TaxId:9615] [257248] (3 PDB entries)
  8. 2805587Domain d4oddb_: 4odd B: [263277]
    automated match to d1gt1a_

Details for d4oddb_

PDB Entry: 4odd (more details), 2.6 Å

PDB Description: Crystal structure of a dog lipocalin allergen
PDB Compounds: (B:) lipocalin allergen

SCOPe Domain Sequences for d4oddb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oddb_ b.60.1.0 (B:) automated matches {Canis lupus [TaxId: 9615]}
pnvltqvsgpwktlyvssnnldkigengpfriylrginvdiprlkmlfnfyvkvdgecve
nsvgasigrdnlikgeynggnyfriidmtpnaligydvnvdskgkitkvallmgrgahvn
eediakfkklsrekgipeeniiylgdtdncpn

SCOPe Domain Coordinates for d4oddb_:

Click to download the PDB-style file with coordinates for d4oddb_.
(The format of our PDB-style files is described here.)

Timeline for d4oddb_: