![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
![]() | Protein automated matches [190698] (25 species) not a true protein |
![]() | Species Canis lupus [TaxId:9615] [257248] (3 PDB entries) |
![]() | Domain d4odda_: 4odd A: [257249] automated match to d1gt1a_ |
PDB Entry: 4odd (more details), 2.6 Å
SCOPe Domain Sequences for d4odda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4odda_ b.60.1.0 (A:) automated matches {Canis lupus [TaxId: 9615]} tqvsgpwktlyvssnnldkigengpfriylrginvdiprlkmlfnfyvkvdgecvensvg asigrdnlikgeynggnyfriidmtpnaligydvnvdskgkitkvallmgrgahvneedi akfkklsrekgipeeniiylgdtdncpnh
Timeline for d4odda_: