Class b: All beta proteins [48724] (119 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins) |
Protein Factor D [50563] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50564] (7 PDB entries) |
Domain d1dst__: 1dst - [26318] mutant |
PDB Entry: 1dst (more details), 2 Å
SCOP Domain Sequences for d1dst__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dst__ b.47.1.2 (-) Factor D {Human (Homo sapiens)} ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl sqpepskrlydvlravphpdyqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck gdsggplvcggvlegvvswgsrvcgnrkkpgiytrvasyaawidsvla
Timeline for d1dst__: