SCOP 1.63: Domain d1dst__: 1dst -

Lineage for d1dst__ (1dst -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)

6. Protein Factor D [50563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50564] (7 PDB entries)

8. Domain d1dst__: 1dst - [26318]
   mutant

Details for d1dst__

PDB Entry: 1dst, 2 Å

PDB Description: mutant of factor d with enhanced catalytic activity

SCOP Domain Sequences for d1dst__:

Sequence; same for both SEQRES and ATOM records:

>d1dst__ b.47.1.2 (-) Factor D {Human (Homo sapiens)}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdyqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvswgsrvcgnrkkpgiytrvasyaawidsvla

Timeline for d1dst__:

• d1dst__ first appeared (with stable ids) in SCOP 1.55
  
• d1dst__ appears in SCOP 1.61
  
• d1dst__ appears in SCOP 1.65
  
• d1dst__ appears in the current release, SCOPe 2.08, called d1dsta_