Lineage for d1dsta_ (1dst A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795529Protein Factor D [50563] (1 species)
  7. 2795530Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries)
  8. 2795548Domain d1dsta_: 1dst A: [26318]
    mutant

Details for d1dsta_

PDB Entry: 1dst (more details), 2 Å

PDB Description: mutant of factor d with enhanced catalytic activity
PDB Compounds: (A:) factor d

SCOPe Domain Sequences for d1dsta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsta_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdyqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvswgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d1dsta_:

Click to download the PDB-style file with coordinates for d1dsta_.
(The format of our PDB-style files is described here.)

Timeline for d1dsta_: