Lineage for d1bio__ (1bio -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Factor D [50563] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50564] (7 PDB entries) 
Domain d1bio__: 1bio - [26314]
Details for d1bio__
PDB Entry: 1bio (more details), 1.5 Å
PDB Description: human complement factor d in complex with isatoic anhydride inhibitor
SCOP Domain Sequences for d1bio__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bio__ b.47.1.2 (-) Factor D {Human (Homo sapiens)}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
SCOP Domain Coordinates for d1bio__:
Click to download the PDB-style file with coordinates for d1bio__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bio__:
- d1bio__ appears in SCOP 1.57
- d1bio__ appears in the current release, SCOPe 2.08, called d1bioa_
View in 3D