![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein 7S NGF protease subunits [50559] (1 species) two pairs of homologous but non-identical chains |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [50560] (1 PDB entry) |
![]() | Domain d1sgfx_: 1sgf X: [26310] Other proteins in same PDB: d1sgfb_, d1sgfy_ complexed with nag, zn |
PDB Entry: 1sgf (more details), 3.15 Å
SCOPe Domain Sequences for d1sgfx_:
Sequence, based on SEQRES records: (download)
>d1sgfx_ b.47.1.2 (X:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} sqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgknnfledepsdqhrlvsk aiphpdfnmsllnehtpqpeddysndlmllrlskpaditdvvkpitlpteepklgstcla sgwgsttpikfkypddlqcvnlkllpnedcdkahemkvtdamlcagemdggsytcehdsg gplicdgilqgitswgpepcgeptepsvytklikfsswiretman
>d1sgfx_ b.47.1.2 (X:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} sqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgkddqhrlvskaiphpdfn msllnehtpqpeddysndlmllrlskpaditdvvkpitlpteepklgstclasgtcvnlk llpnedcdkahemkvtdamlcagemdggsytcehdsggplicdgilqgitswgpepcgep tepsvytklikfsswiretman
Timeline for d1sgfx_: