PDB entry 1sgf

View 1sgf on RCSB PDB site
Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
Class: growth factor
Keywords: growth factor (beta-ngf), hydrolase - serine proteinase (gamma-ngf), inactive serine proteinase (alpha-ngf), growth factor
Deposited on 1997-08-08, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.246
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgfa_
  • Chain 'B':
    Compound: nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgfb_
  • Chain 'G':
    Compound: nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgfg_
  • Chain 'X':
    Compound: nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgfx_
  • Chain 'Y':
    Compound: nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgfy_
  • Chain 'Z':
    Compound: nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgfz_
  • Heterogens: NAG, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sgfA (A:)
    aappvqsqvdcensqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgknnfl
    edepsdqhrlvskaiphpdfnmsllnehtpqpeddysndlmllrlskpaditdvvkpitl
    pteepklgstclasgwgsttpikfkypddlqcvnlkllpnedcdkahemkvtdamlcage
    mdggsytcehdsggplicdgilqgitswgpepcgeptepsvytklikfsswiretmannp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgfA (A:)
    nsqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgkeepsdqhrlvskaiph
    pdfnmsllpqpeddysndlmllrlskpaditdvvkpitlpteepklgstclasicvnlkl
    lpnedcdkahemkvtdamlcagemdggsytcehdsggplicdgilqgitswgpepcgept
    epsvytklikfsswiretmannp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sgfB (B:)
    ssthpvfhmgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcra
    snpvesgcrgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgfB (B:)
    gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
    gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sgfG (G:)
    ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
    psaqhrfvskaiphpgfnmslmrkhirfleydysndlmllrlskpaditdtvkpitlpte
    epklgstclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdg
    gkdtckgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgfG (G:)
    ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
    psaqhrfvskaiphpgfnmslmfleydysndlmllrlskpaditdtvkpitlpteepklg
    stclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdggkdtc
    kgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1sgfX (X:)
    aappvqsqvdcensqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgknnfl
    edepsdqhrlvskaiphpdfnmsllnehtpqpeddysndlmllrlskpaditdvvkpitl
    pteepklgstclasgwgsttpikfkypddlqcvnlkllpnedcdkahemkvtdamlcage
    mdggsytcehdsggplicdgilqgitswgpepcgeptepsvytklikfsswiretmannp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgfX (X:)
    sqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgkddqhrlvskaiphpdfn
    msllnehtpqpeddysndlmllrlskpaditdvvkpitlpteepklgstclasgtcvnlk
    llpnedcdkahemkvtdamlcagemdggsytcehdsggplicdgilqgitswgpepcgep
    tepsvytklikfsswiretman
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1sgfY (Y:)
    ssthpvfhmgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcra
    snpvesgcrgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgfY (Y:)
    hmgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesg
    crgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1sgfZ (Z:)
    ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
    psaqhrfvskaiphpgfnmslmrkhirfleydysndlmllrlskpaditdtvkpitlpte
    epklgstclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdg
    gkdtckgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgfZ (Z:)
    ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
    psaqhrfvskaiphpgfnmslmfleydysndlmllrlskpaditdtvkpitlpteepklg
    stclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdggkdtc
    kgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp