SCOPe 2.08: Domain d1sgfz_: 1sgf Z:

Lineage for d1sgfz_ (1sgf Z:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein 7S NGF protease subunits [50559] (1 species)
   two pairs of homologous but non-identical chains

7. Species Mouse (Mus musculus) [TaxId:10090] [50560] (1 PDB entry)

8. Domain d1sgfz_: 1sgf Z: [26311]
   Other proteins in same PDB: d1sgfb_, d1sgfy_
   complexed with nag, zn

Details for d1sgfz_

PDB Entry: 1sgf, 3.15 Å

PDB Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)

PDB Compounds: (Z:) nerve growth factor

SCOPe Domain Sequences for d1sgfz_:

Sequence, based on SEQRES records:

>d1sgfz_ b.47.1.2 (Z:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
psaqhrfvskaiphpgfnmslmrkhirfleydysndlmllrlskpaditdtvkpitlpte
epklgstclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdg
gkdtckgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp

Sequence, based on observed residues (ATOM records):

>d1sgfz_ b.47.1.2 (Z:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
psaqhrfvskaiphpgfnmslmfleydysndlmllrlskpaditdtvkpitlpteepklg
stclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdggkdtc
kgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp

Timeline for d1sgfz_:

• d1sgfz_ first appeared (with stable ids) in SCOP 1.55
  
• d1sgfz_ appears in SCOPe 2.07