Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) contains insert beta-sheet subdomain and C-terminal helix |
Family b.34.6.2: Kid/PemK [82075] (4 proteins) automatically mapped to Pfam PF02452 |
Protein automated matches [228538] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:158879] [257115] (4 PDB entries) |
Domain d4mzmc1: 4mzm C:2-113 [263079] Other proteins in same PDB: d4mzma2, d4mzmb2, d4mzmc2, d4mzmd2 automated match to d2mf2a_ |
PDB Entry: 4mzm (more details), 2.1 Å
SCOPe Domain Sequences for d4mzmc1:
Sequence, based on SEQRES records: (download)
>d4mzmc1 b.34.6.2 (C:2-113) automated matches {Staphylococcus aureus [TaxId: 158879]} irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthvei ekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
>d4mzmc1 b.34.6.2 (C:2-113) automated matches {Staphylococcus aureus [TaxId: 158879]} irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgakipthveiekyk ldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
Timeline for d4mzmc1: