SCOPe 2.08: Domain d4mzmc1: 4mzm C:2-113

Lineage for d4mzmc1 (4mzm C:2-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein automated matches [228538] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [257115] (4 PDB entries)

8. Domain d4mzmc1: 4mzm C:2-113 [263079]
   Other proteins in same PDB: d4mzma2, d4mzmb2, d4mzmc2, d4mzmd2
   automated match to d2mf2a_

Details for d4mzmc1

PDB Entry: 4mzm, 2.1 Å

PDB Description: MazF from S. aureus crystal form I, P212121, 2.1 A

PDB Compounds: (C:) mRNA interferase MazF

SCOPe Domain Sequences for d4mzmc1:

Sequence, based on SEQRES records:

>d4mzmc1 b.34.6.2 (C:2-113) automated matches {Staphylococcus aureus [TaxId: 158879]}
irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthvei
ekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln

Sequence, based on observed residues (ATOM records):

>d4mzmc1 b.34.6.2 (C:2-113) automated matches {Staphylococcus aureus [TaxId: 158879]}
irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgakipthveiekyk
ldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln

Timeline for d4mzmc1:

• d4mzmc1 first appeared in SCOPe 2.05, called d4mzmc_
  
• d4mzmc1 appears in SCOPe 2.07