Lineage for d4mzmb1 (4mzm B:2-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784312Family b.34.6.2: Kid/PemK [82075] (4 proteins)
    automatically mapped to Pfam PF02452
  6. 2784335Protein automated matches [228538] (6 species)
    not a true protein
  7. 2784362Species Staphylococcus aureus [TaxId:158879] [257115] (4 PDB entries)
  8. 2784364Domain d4mzmb1: 4mzm B:2-113 [257117]
    Other proteins in same PDB: d4mzma2, d4mzmb2, d4mzmc2, d4mzmd2
    automated match to d4hkea_

Details for d4mzmb1

PDB Entry: 4mzm (more details), 2.1 Å

PDB Description: MazF from S. aureus crystal form I, P212121, 2.1 A
PDB Compounds: (B:) mRNA interferase MazF

SCOPe Domain Sequences for d4mzmb1:

Sequence, based on SEQRES records: (download)

>d4mzmb1 b.34.6.2 (B:2-113) automated matches {Staphylococcus aureus [TaxId: 158879]}
irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthvei
ekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln

Sequence, based on observed residues (ATOM records): (download)

>d4mzmb1 b.34.6.2 (B:2-113) automated matches {Staphylococcus aureus [TaxId: 158879]}
irrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrakipthveieky
kldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln

SCOPe Domain Coordinates for d4mzmb1:

Click to download the PDB-style file with coordinates for d4mzmb1.
(The format of our PDB-style files is described here.)

Timeline for d4mzmb1: