PDB entry 4mzm

View 4mzm on RCSB PDB site
Description: MazF from S. aureus crystal form I, P212121, 2.1 A
Class: hydrolase
Keywords: CcdB/MazF fold, ribonuclease, MazE, mRNA interferase, HYDROLASE
Deposited on 2013-09-30, released 2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA interferase MazF
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (12-13)
    Domains in SCOPe 2.07: d4mzma1, d4mzma2
  • Chain 'B':
    Compound: mRNA interferase MazF
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (12-13)
    Domains in SCOPe 2.07: d4mzmb1, d4mzmb2
  • Chain 'C':
    Compound: mRNA interferase MazF
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (12-13)
    Domains in SCOPe 2.07: d4mzmc1, d4mzmc2
  • Chain 'D':
    Compound: mRNA interferase MazF
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: mazF, SA1873
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A4G9 (14-End)
      • expression tag (12-13)
    Domains in SCOPe 2.07: d4mzmd1, d4mzmd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4mzmA (A:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzmA (A:)
    dpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthv
    eiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislglna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4mzmB (B:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzmB (B:)
    dpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrakipthveie
    kykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4mzmC (C:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzmC (C:)
    dpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgakipthveiek
    ykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4mzmD (D:)
    mgsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaait
    grinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalm
    islglnavahqkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4mzmD (D:)
    dpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitgrinkakipthv
    eiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmislgln