SCOPe 2.07: Domain d1hia.1: 1hia A:,B:

Lineage for d1hia.1 (1hia A:,B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Kallikrein A [50555] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries)

8. Domain d1hia.1: 1hia A:,B: [26304]
   Other proteins in same PDB: d1hiai_, d1hiaj_

Details for d1hia.1

PDB Entry: 1hia, 2.4 Å

PDB Description: kallikrein complexed with hirustasin

PDB Compounds: (A:) kallikrein, (B:) kallikrein

SCOPe Domain Sequences for d1hia.1:

Sequence; same for both SEQRES and ATOM records:

>g1hia.1 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]}
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnlsXgkdyshdlmllrlqspakitdavkvlelptqepelgstc
easgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdtcm
gdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp

Timeline for d1hia.1:

• d1hia.1 first appeared (with stable ids) in SCOP 1.55
  
• d1hia.1 appears in SCOPe 2.06
  
• d1hia.1 appears in the current release, SCOPe 2.08