SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1hia.1 (1hia A:,B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056512Protein Kallikrein A [50555] (1 species)
  7. 2056513Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries)
  8. 2056516Domain d1hia.1: 1hia A:,B: [26304]
    Other proteins in same PDB: d1hiai_, d1hiaj_

Details for d1hia.1

PDB Entry: 1hia (more details), 2.4 Å

PDB Description: kallikrein complexed with hirustasin
PDB Compounds: (A:) kallikrein, (B:) kallikrein

SCOPe Domain Sequences for d1hia.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1hia.1 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]}
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnlsXgkdyshdlmllrlqspakitdavkvlelptqepelgstc
easgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdtcm
gdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp

SCOPe Domain Coordinates for d1hia.1:

Click to download the PDB-style file with coordinates for d1hia.1.
(The format of our PDB-style files is described here.)

Timeline for d1hia.1: