SCOP 1.63: Domain d1hrt.1: 1hrt L:,H:

Lineage for d1hrt.1 (1hrt L:,H:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)

8. Domain d1hrt.1: 1hrt L:,H: [26221]
   Other proteins in same PDB: d1hrti_

Details for d1hrt.1

PDB Entry: 1hrt, 2.8 Å

PDB Description: the structure of a complex of bovine alpha-thrombin and recombinant hirudin at 2.8 angstroms resolution

SCOP Domain Sequences for d1hrt.1:

Sequence; same for both SEQRES and ATOM records:

>g1hrt.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

Timeline for d1hrt.1:

• d1hrt.1 first appeared (with stable ids) in SCOP 1.55
  
• d1hrt.1 appears in SCOP 1.61
  
• d1hrt.1 appears in SCOP 1.65
  
• d1hrt.1 appears in the current release, SCOPe 2.08