![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) |
![]() | Protein Thrombin [50531] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries) |
![]() | Domain d1hrt.1: 1hrt L:,H: [26221] Other proteins in same PDB: d1hrti_ |
PDB Entry: 1hrt (more details), 2.8 Å
SCOP Domain Sequences for d1hrt.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1hrt.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)} tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs
Timeline for d1hrt.1: