Lineage for d4wwoa4 (4wwo A:726-1090)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542186Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (2 proteins)
  6. 2542190Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2542191Species Human (Homo sapiens) [TaxId:9606] [56174] (72 PDB entries)
  8. 2542219Domain d4wwoa4: 4wwo A:726-1090 [262153]
    Other proteins in same PDB: d4wwoa1, d4wwoa2, d4wwoa3
    automated match to d1e7ua4
    complexed with 3vd, so4

Details for d4wwoa4

PDB Entry: 4wwo (more details), 2.3 Å

PDB Description: crystal structure of human pi3k-gamma in complex with phenylquinoline inhibitor n-{(1s)-1-[8-chloro-2-(3-fluorophenyl)quinolin-3-yl]ethyl}- 9h-purin-6-amine
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4wwoa4:

Sequence, based on SEQRES records: (download)

>d4wwoa4 d.144.1.4 (A:726-1090) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhl

Sequence, based on observed residues (ATOM records): (download)

>d4wwoa4 d.144.1.4 (A:726-1090) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsvssqvisqlkqklenlqnsqlpesfrvpydpg
lkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilri
mesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgfkdevlnhwlkek
spteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghikervpf
vltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmptsked
ieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhl

SCOPe Domain Coordinates for d4wwoa4:

Click to download the PDB-style file with coordinates for d4wwoa4.
(The format of our PDB-style files is described here.)

Timeline for d4wwoa4: