Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) |
Family b.1.15.0: automated matches [233856] (1 protein) not a true family |
Protein automated matches [233857] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries) |
Domain d4um8c2: 4um8 C:439-594 [262021] Other proteins in same PDB: d4um8a1, d4um8c1 automated match to d1m1xa1 complexed with ca, cac, cl, mg, nag, ni, so4 |
PDB Entry: 4um8 (more details), 2.85 Å
SCOPe Domain Sequences for d4um8c2:
Sequence, based on SEQRES records: (download)
>d4um8c2 b.1.15.0 (C:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif meyrldyrtaadttglqpilnqftpanisrqahill
>d4um8c2 b.1.15.0 (C:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitifme yrldyrtattglqpilnqftpanisrqahill
Timeline for d4um8c2: