Lineage for d4um8a2 (4um8 A:439-594)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032015Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2032044Family b.1.15.0: automated matches [233856] (1 protein)
    not a true family
  6. 2032045Protein automated matches [233857] (1 species)
    not a true protein
  7. 2032046Species Human (Homo sapiens) [TaxId:9606] [233858] (12 PDB entries)
  8. 2032057Domain d4um8a2: 4um8 A:439-594 [262020]
    Other proteins in same PDB: d4um8a1, d4um8c1
    automated match to d1m1xa1
    complexed with ca, cac, cl, mg, nag, ni, so4

Details for d4um8a2

PDB Entry: 4um8 (more details), 2.85 Å

PDB Description: Crystal structure of alpha V beta 6
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d4um8a2:

Sequence, based on SEQRES records: (download)

>d4um8a2 b.1.15.0 (A:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahill

Sequence, based on observed residues (ATOM records): (download)

>d4um8a2 b.1.15.0 (A:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitifmey
rldyrtaadttglqpilnqftpanisrqahill

SCOPe Domain Coordinates for d4um8a2:

Click to download the PDB-style file with coordinates for d4um8a2.
(The format of our PDB-style files is described here.)

Timeline for d4um8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4um8a1