Lineage for d4um8c1 (4um8 C:1-438)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066356Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2066357Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 protein domains)
  6. 2066399Protein automated matches [254690] (1 species)
    not a true protein
  7. 2066400Species Human (Homo sapiens) [TaxId:9606] [255892] (11 PDB entries)
  8. 2066406Domain d4um8c1: 4um8 C:1-438 [262019]
    Other proteins in same PDB: d4um8a2, d4um8c2
    automated match to d1m1xa4
    complexed with ca, cac, cl, mg, nag, ni, so4

Details for d4um8c1

PDB Entry: 4um8 (more details), 2.85 Å

PDB Description: Crystal structure of alpha V beta 6
PDB Compounds: (C:) Integrin alpha-V

SCOPe Domain Sequences for d4um8c1:

Sequence, based on SEQRES records: (download)

>d4um8c1 b.69.8.1 (C:1-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarscppsfgysmkgatdidkngyp
dlivgafgvdrailyrar

Sequence, based on observed residues (ATOM records): (download)

>d4um8c1 b.69.8.1 (C:1-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpssrmfllvgapkanttqpgiveggqvlkcdws
strrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkqer
epvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywqgq
lisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfvsg
vpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplfmd
rgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiaiaa
pyggedkkgivyifngrstglnavpsqilegqwaarscppsfgysmkgatdidkngypdl
ivgafgvdrailyrar

SCOPe Domain Coordinates for d4um8c1:

Click to download the PDB-style file with coordinates for d4um8c1.
(The format of our PDB-style files is described here.)

Timeline for d4um8c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4um8c2