![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
![]() | Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
![]() | Family a.55.1.0: automated matches [191573] (1 protein) not a true family |
![]() | Protein automated matches [191007] (11 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [261909] (1 PDB entry) |
![]() | Domain d4qjna_: 4qjn A: [261913] automated match to d4dkyb_ |
PDB Entry: 4qjn (more details), 2.61 Å
SCOPe Domain Sequences for d4qjna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qjna_ a.55.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]} mnktdlinavaeqadltkkeagsavdavfesiqnslakgekvqligfgnfevreraarkg rnpqtgkeidipaskvpafkagkalkdavk
Timeline for d4qjna_: