Lineage for d4qjnd_ (4qjn D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715207Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2715208Protein automated matches [191007] (11 species)
    not a true protein
  7. 2715240Species Staphylococcus aureus [TaxId:158878] [261909] (1 PDB entry)
  8. 2715244Domain d4qjnd_: 4qjn D: [261912]
    automated match to d4dkyb_

Details for d4qjnd_

PDB Entry: 4qjn (more details), 2.61 Å

PDB Description: Crystal structure of apo nucleoid associated protein, SAV1473
PDB Compounds: (D:) DNA-binding protein HU

SCOPe Domain Sequences for d4qjnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qjnd_ a.55.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mnktdlinavaeqadltkkeagsavdavfesiqnslakgekvqligfgnfevreraarkg
rnpqtgkeidipaskvpafkagkalkdavk

SCOPe Domain Coordinates for d4qjnd_:

Click to download the PDB-style file with coordinates for d4qjnd_.
(The format of our PDB-style files is described here.)

Timeline for d4qjnd_: