Lineage for d4rurw_ (4rur W:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2990995Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2991939Domain d4rurw_: 4rur W: [261590]
    Other proteins in same PDB: d4rurb_, d4rurc1, d4rurc2, d4rurd_, d4rure_, d4rurf_, d4rurg_, d4rurh_, d4rurm_, d4rurp_, d4rurq1, d4rurq2, d4rurr_, d4rurs_, d4rurt_, d4ruru_, d4rurv_
    automated match to d1g0ui_
    complexed with 3we, mg

Details for d4rurw_

PDB Entry: 4rur (more details), 2.5 Å

PDB Description: yeast 20s proteasome in complex with the alkaloid indolo-phakellin (4)
PDB Compounds: (W:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d4rurw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rurw_ d.153.1.4 (W:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d4rurw_:

Click to download the PDB-style file with coordinates for d4rurw_.
(The format of our PDB-style files is described here.)

Timeline for d4rurw_: