Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4rurf_: 4rur F: [261586] Other proteins in same PDB: d4rura_, d4rurc2, d4rure_, d4rurg_, d4ruri_, d4rurj_, d4rurk_, d4rurl_, d4rurn_, d4ruro_, d4rurq2, d4rurs_, d4ruru_, d4rurw_, d4rurx_, d4rury_, d4rurz_ automated match to d4g4sg_ complexed with 3we, mg |
PDB Entry: 4rur (more details), 2.5 Å
SCOPe Domain Sequences for d4rurf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rurf_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk ein
Timeline for d4rurf_:
View in 3D Domains from other chains: (mouse over for more information) d4rura_, d4rurb_, d4rurc1, d4rurc2, d4rurd_, d4rure_, d4rurg_, d4rurh_, d4ruri_, d4rurj_, d4rurk_, d4rurl_, d4rurm_, d4rurn_, d4ruro_, d4rurp_, d4rurq1, d4rurq2, d4rurr_, d4rurs_, d4rurt_, d4ruru_, d4rurv_, d4rurw_, d4rurx_, d4rury_, d4rurz_ |