SCOPe 2.05: Domain d3wfta_: 3wft A:

Lineage for d3wfta_ (3wft A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (80 PDB entries)

8. Domain d3wfta_: 3wft A: [261470]
   automated match to d1gjna_
   complexed with gol, j1r, j1s, so4

Details for d3wfta_

PDB Entry: 3wft, 1.3 Å

PDB Description: crystal structure of horse heart myoglobin reconstituted with cobalt(ii) tetradehydrocorrin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3wfta_:

Sequence; same for both SEQRES and ATOM records:

>d3wfta_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d3wfta_:

• d3wfta_ first appeared in SCOPe 2.04
  
• d3wfta_ appears in SCOPe 2.06
  
• d3wfta_ appears in the current release, SCOPe 2.08