PDB entry 3wft

View 3wft on RCSB PDB site
Description: Crystal structure of horse heart myoglobin reconstituted with cobalt(II) tetradehydrocorrin
Class: oxygen transport
Keywords: globin fold, Oxygen transport, muscles
Deposited on 2013-07-23, released 2014-12-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.129
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3wfta_
  • Heterogens: J1R, J1S, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wftA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg