Lineage for d4ub6u_ (4ub6 U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329766Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2329767Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 2329772Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)
  8. 2329780Domain d4ub6u_: 4ub6 U: [261427]
    Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6h_, d4ub6i_, d4ub6j_, d4ub6k_, d4ub6l_, d4ub6m_, d4ub6o_, d4ub6t_, d4ub6v_, d4ub6x_, d4ub6z_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub6u_

PDB Entry: 4ub6 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d4ub6u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub6u_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d4ub6u_:

Click to download the PDB-style file with coordinates for d4ub6u_.
(The format of our PDB-style files is described here.)

Timeline for d4ub6u_: