Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (6 PDB entries) |
Domain d4ub6u_: 4ub6 U: [261427] Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6h_, d4ub6i_, d4ub6j_, d4ub6k_, d4ub6l_, d4ub6m_, d4ub6o_, d4ub6t_, d4ub6v_, d4ub6x_, d4ub6z_ automated match to d2axtu1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 4ub6 (more details), 1.95 Å
SCOPe Domain Sequences for d4ub6u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ub6u_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]} elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl terqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d4ub6u_: