Lineage for d4ub6h_ (4ub6 H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631822Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 2631823Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2631855Protein automated matches [191001] (5 species)
    not a true protein
  7. 2631867Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (7 PDB entries)
  8. 2631871Domain d4ub6h_: 4ub6 H: [261418]
    Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6i_, d4ub6j_, d4ub6k_, d4ub6l_, d4ub6m_, d4ub6o_, d4ub6t_, d4ub6u_, d4ub6v_, d4ub6x_, d4ub6z_
    automated match to d3bz2h_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub6h_

PDB Entry: 4ub6 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d4ub6h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub6h_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

SCOPe Domain Coordinates for d4ub6h_:

Click to download the PDB-style file with coordinates for d4ub6h_.
(The format of our PDB-style files is described here.)

Timeline for d4ub6h_: