Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (49 species) not a true protein |
Species Lactobacillus casei [TaxId:321967] [260805] (4 PDB entries) |
Domain d4wxea_: 4wxe A: [261331] automated match to d2o20b_ complexed with cl, edo, mg, trs |
PDB Entry: 4wxe (more details), 1.5 Å
SCOPe Domain Sequences for d4wxea_:
Sequence, based on SEQRES records: (download)
>d4wxea_ c.93.1.0 (A:) automated matches {Lactobacillus casei [TaxId: 321967]} smlraqatgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkql ksreldgvilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldyl fnqghrrfayvsggtisgahhgqsrtqafldfmqahqllvaqdllfgqihtakegqavgk qlaslapnvrpdavftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakipltt vhqpvasmaaaathellkglgrqvaqdtqptlhlslkirqsa
>d4wxea_ c.93.1.0 (A:) automated matches {Lactobacillus casei [TaxId: 321967]} smlraqatgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkql ksreldgvilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldyl fnqghrrfayvsggtisgahhgqsrtqafldfmqahqllvaqdllfgqihtakegqavgk qlaslapnvrpdavftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakipltt vhqpvasmaaaathellkglgrqvaqtlhlslkirqsa
Timeline for d4wxea_: