Lineage for d4wxea1 (4wxe A:54-333)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144169Species Lactobacillus casei [TaxId:321967] [260805] (4 PDB entries)
  8. 2144172Domain d4wxea1: 4wxe A:54-333 [261331]
    Other proteins in same PDB: d4wxea2
    automated match to d2o20b_
    complexed with cl, edo, mg, trs

Details for d4wxea1

PDB Entry: 4wxe (more details), 1.5 Å

PDB Description: crystal structure of a laci regulator from lactobacillus casei (lsei_2103, target efi-512911) with bound tris
PDB Compounds: (A:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d4wxea1:

Sequence, based on SEQRES records: (download)

>d4wxea1 c.93.1.0 (A:54-333) automated matches {Lactobacillus casei [TaxId: 321967]}
lraqatgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkqlks
reldgvilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldylfn
qghrrfayvsggtisgahhgqsrtqafldfmqahqllvaqdllfgqihtakegqavgkql
aslapnvrpdavftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakiplttvh
qpvasmaaaathellkglgrqvaqdtqptlhlslkirqsa

Sequence, based on observed residues (ATOM records): (download)

>d4wxea1 c.93.1.0 (A:54-333) automated matches {Lactobacillus casei [TaxId: 321967]}
lraqatgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkqlks
reldgvilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldylfn
qghrrfayvsggtisgahhgqsrtqafldfmqahqllvaqdllfgqihtakegqavgkql
aslapnvrpdavftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakiplttvh
qpvasmaaaathellkglgrqvaqtlhlslkirqsa

SCOPe Domain Coordinates for d4wxea1:

Click to download the PDB-style file with coordinates for d4wxea1.
(The format of our PDB-style files is described here.)

Timeline for d4wxea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wxea2