Lineage for d3wmsa4 (3wms A:616-716)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768737Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. 2768738Protein automated matches [254436] (5 species)
    not a true protein
  7. 2768760Species Paenibacillus macerans [TaxId:44252] [256326] (4 PDB entries)
  8. 2768762Domain d3wmsa4: 3wms A:616-716 [261013]
    Other proteins in same PDB: d3wmsa1, d3wmsa2, d3wmsa3
    automated match to d4jcla4
    complexed with ca; mutant

Details for d3wmsa4

PDB Entry: 3wms (more details), 2.3 Å

PDB Description: The crystal structure of Y195I mutant alpha-cyclodextrin glycosyltransferase from Paenibacillus macerans
PDB Compounds: (A:) Alpha-cyclodextrin glucanotransferase

SCOPe Domain Sequences for d3wmsa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmsa4 b.3.1.0 (A:616-716) automated matches {Paenibacillus macerans [TaxId: 44252]}
gdqvtmrflvnqantnygtnvylvgnaaelgswdpnkaigpmynqviakypswyydvsvp
agtkldfkfikkgggtvtwegggnhtyttpassvgtvtvdw

SCOPe Domain Coordinates for d3wmsa4:

Click to download the PDB-style file with coordinates for d3wmsa4.
(The format of our PDB-style files is described here.)

Timeline for d3wmsa4: