![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
![]() | Family b.3.1.0: automated matches [254199] (1 protein) not a true family |
![]() | Protein automated matches [254436] (5 species) not a true protein |
![]() | Species Paenibacillus macerans [TaxId:44252] [256326] (4 PDB entries) |
![]() | Domain d3wmsa4: 3wms A:616-716 [261013] Other proteins in same PDB: d3wmsa1, d3wmsa2, d3wmsa3 automated match to d4jcla4 complexed with ca; mutant |
PDB Entry: 3wms (more details), 2.3 Å
SCOPe Domain Sequences for d3wmsa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmsa4 b.3.1.0 (A:616-716) automated matches {Paenibacillus macerans [TaxId: 44252]} gdqvtmrflvnqantnygtnvylvgnaaelgswdpnkaigpmynqviakypswyydvsvp agtkldfkfikkgggtvtwegggnhtyttpassvgtvtvdw
Timeline for d3wmsa4: