Lineage for d3wmsa3 (3wms A:529-615)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766480Species Paenibacillus macerans [TaxId:44252] [256324] (4 PDB entries)
  8. 2766482Domain d3wmsa3: 3wms A:529-615 [261012]
    Other proteins in same PDB: d3wmsa1, d3wmsa2, d3wmsa4
    automated match to d4jcla3
    complexed with ca; mutant

Details for d3wmsa3

PDB Entry: 3wms (more details), 2.3 Å

PDB Description: The crystal structure of Y195I mutant alpha-cyclodextrin glycosyltransferase from Paenibacillus macerans
PDB Compounds: (A:) Alpha-cyclodextrin glucanotransferase

SCOPe Domain Sequences for d3wmsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmsa3 b.1.18.0 (A:529-615) automated matches {Paenibacillus macerans [TaxId: 44252]}
tspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgsgivswedtqikavipkv
aagktgvsvktssgtasntfksfnvlt

SCOPe Domain Coordinates for d3wmsa3:

Click to download the PDB-style file with coordinates for d3wmsa3.
(The format of our PDB-style files is described here.)

Timeline for d3wmsa3: