![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Paenibacillus macerans [TaxId:44252] [256322] (4 PDB entries) |
![]() | Domain d3wmsa2: 3wms A:439-528 [261011] Other proteins in same PDB: d3wmsa1, d3wmsa3, d3wmsa4 automated match to d4jcla2 complexed with ca; mutant |
PDB Entry: 3wms (more details), 2.3 Å
SCOPe Domain Sequences for d3wmsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmsa2 b.71.1.0 (A:439-528) automated matches {Paenibacillus macerans [TaxId: 44252]} gttterwvnndvliierkfgssaalvainrnssaaypisgllsslpagtysdvlngllng nsitvgsggavtnftlaaggtavwqytape
Timeline for d3wmsa2: