Lineage for d3wmsa2 (3wms A:439-528)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811146Species Paenibacillus macerans [TaxId:44252] [256322] (4 PDB entries)
  8. 2811148Domain d3wmsa2: 3wms A:439-528 [261011]
    Other proteins in same PDB: d3wmsa1, d3wmsa3, d3wmsa4
    automated match to d4jcla2
    complexed with ca; mutant

Details for d3wmsa2

PDB Entry: 3wms (more details), 2.3 Å

PDB Description: The crystal structure of Y195I mutant alpha-cyclodextrin glycosyltransferase from Paenibacillus macerans
PDB Compounds: (A:) Alpha-cyclodextrin glucanotransferase

SCOPe Domain Sequences for d3wmsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmsa2 b.71.1.0 (A:439-528) automated matches {Paenibacillus macerans [TaxId: 44252]}
gttterwvnndvliierkfgssaalvainrnssaaypisgllsslpagtysdvlngllng
nsitvgsggavtnftlaaggtavwqytape

SCOPe Domain Coordinates for d3wmsa2:

Click to download the PDB-style file with coordinates for d3wmsa2.
(The format of our PDB-style files is described here.)

Timeline for d3wmsa2: