Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
Superfamily d.223.1: Polo-box domain [82615] (2 families) Serine/threonine protein kinase-associated motif embedded in two distinct folds |
Family d.223.1.2: Polo-box duplicated region [102856] (1 protein) duplication: consists of two polo-box domains; binds phosphothreonine peptide |
Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102858] (18 PDB entries) |
Domain d4rcpa2: 4rcp A:501-599 [260959] automated match to d3hika2 complexed with edo |
PDB Entry: 4rcp (more details), 1.6 Å
SCOPe Domain Sequences for d4rcpa2:
Sequence, based on SEQRES records: (download)
>d4rcpa2 d.223.1.2 (A:501-599) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} egdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfr tyrlslleeygcckelasrlryartmvdkllssrsasnr
>d4rcpa2 d.223.1.2 (A:501-599) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} eglpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrtyrls lleeygcckelasrlryartmvdkllssrsasnr
Timeline for d4rcpa2: