SCOPe 2.08: Domain d4rcpa2: 4rcp A:501-599

Lineage for d4rcpa2 (4rcp A:501-599)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (3 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries)

8. Domain d4rcpa2: 4rcp A:501-599 [260959]
   automated match to d3hika2
   complexed with edo

Details for d4rcpa2

PDB Entry: 4rcp, 1.6 Å

PDB Description: Crystal structure of Plk1 Polo-box domain in complex with PL-2

PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d4rcpa2:

Sequence, based on SEQRES records:

>d4rcpa2 d.223.1.2 (A:501-599) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
egdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfr
tyrlslleeygcckelasrlryartmvdkllssrsasnr

Sequence, based on observed residues (ATOM records):

>d4rcpa2 d.223.1.2 (A:501-599) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eglpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrtyrls
lleeygcckelasrlryartmvdkllssrsasnr

Timeline for d4rcpa2:

• d4rcpa2 first appeared in SCOPe 2.04
  
• d4rcpa2 appears in SCOPe 2.07