Lineage for d1iht.1 (1iht L:,H:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Thrombin [50531] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50532] (112 PDB entries) 
Domain d1iht.1: 1iht L:,H: [26094]
Details for d1iht.1
PDB Entry: 1iht (more details), 2.1 Å
PDB Description: crystal structure of the complex of human alpha-thrombin and non-hydrolyzable bifunctional inhibitors, hirutonin-2 and hirutonin-6
SCOP Domain Sequences for d1iht.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1iht.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)}
geadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpf
vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
SCOP Domain Coordinates for d1iht.1:
Click to download the PDB-style file with coordinates for d1iht.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iht.1:
- d1iht.1 appears in SCOP 1.57
- d1iht.1 appears in the current release, SCOPe 2.08
View in 3D