SCOPe 2.07: Domain d4pj0d_: 4pj0 D:

Lineage for d4pj0d_ (4pj0 D:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries)
   Uniprot Q8CM25 13-352

8. Domain d4pj0d_: 4pj0 D: [260542]
   Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_
   automated match to d2axtd1
   complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0d_

PDB Entry: 4pj0, 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing

PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d4pj0d_:

Sequence; same for both SEQRES and ATOM records:

>d4pj0d_ f.26.1.1 (D:) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]}
gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
tfytknlllnegirawmapqdqphenfvfpeevlprgnal

Timeline for d4pj0d_:

• d4pj0d_ first appeared in SCOPe 2.04
  
• d4pj0d_ appears in SCOPe 2.06
  
• d4pj0d_ appears in the current release, SCOPe 2.08