Lineage for d4pj0b_ (4pj0 B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634050Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2634051Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2634052Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2634053Protein Photosystem II core light harvesting protein PsbB [161079] (2 species)
  7. 2634054Species Thermosynechococcus elongatus [TaxId:146786] [161080] (7 PDB entries)
    Uniprot Q8DIQ1 2-489
  8. 2634056Domain d4pj0b_: 4pj0 B: [260547]
    Other proteins in same PDB: d4pj0a_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_
    automated match to d2axtb1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0b_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (B:) CP47 protein

SCOPe Domain Sequences for d4pj0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0b_ f.55.1.1 (B:) Photosystem II core light harvesting protein PsbB {Thermosynechococcus elongatus [TaxId: 146786]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqvewgfyqkvgdvttrr

SCOPe Domain Coordinates for d4pj0b_:

Click to download the PDB-style file with coordinates for d4pj0b_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0b_: