SCOP 1.63: Domain d1ggd.1: 1ggd A:,B:,C:

Lineage for d1ggd.1 (1ggd A:,B:,C:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (46 PDB entries)

8. Domain d1ggd.1: 1ggd A:,B:,C: [26019]
   complexed with faf, so4

Details for d1ggd.1

PDB Entry: 1ggd, 1.5 Å

PDB Description: crystal structure of gamma chymotrypsin with n-acetyl-leucil- phenylalanine aldehyde bound at the active site

SCOP Domain Sequences for d1ggd.1:

Sequence; same for both SEQRES and ATOM records:

>g1ggd.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXtpdrlqqaslpllsntnckkywgtkikdamicagasg
vsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d1ggd.1:

• d1ggd.1 first appeared (with stable ids) in SCOP 1.55
  
• d1ggd.1 appears in SCOP 1.61
  
• d1ggd.1 appears in SCOP 1.65
  
• d1ggd.1 appears in the current release, SCOPe 2.08