Class b: All beta proteins [48724] (126 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) |
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50523] (46 PDB entries) |
Domain d1ggd.1: 1ggd A:,B:,C: [26019] complexed with faf, so4 |
PDB Entry: 1ggd (more details), 1.5 Å
SCOP Domain Sequences for d1ggd.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ggd.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)} cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp sasddfaagttcvttgwgltryXtpdrlqqaslpllsntnckkywgtkikdamicagasg vsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
Timeline for d1ggd.1: