SCOPe 2.06: Domain d4kxzp1: 4kxz P:1-107

Lineage for d4kxzp1 (4kxz P:1-107)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (22 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
Domain d4kxzp1: 4kxz P:1-107 [259786]
Other proteins in same PDB: d4kxza_, d4kxzb_, d4kxzd_, d4kxze_, d4kxzi2, d4kxzl2, d4kxzm2, d4kxzp2
automated match to d1dn0a1
complexed with mes, pe5

Details for d4kxzp1

PDB Entry: 4kxz (more details), 2.83 Å

PDB Description: crystal structure of tgfb2 in complex with GC2008.

PDB Compounds: (P:) GC1008 Light Chain

SCOPe Domain Sequences for d4kxzp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxzp1 b.1.1.1 (P:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrlei

SCOPe Domain Coordinates for d4kxzp1:

Click to download the PDB-style file with coordinates for d4kxzp1.
(The format of our PDB-style files is described here.)

Timeline for d4kxzp1: