Lineage for d1dn0a1 (1dn0 A:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2022563Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022708Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)
  8. 2022714Domain d1dn0a1: 1dn0 A:1-107 [19830]
    Other proteins in same PDB: d1dn0a2, d1dn0b1, d1dn0b2, d1dn0c2, d1dn0d1, d1dn0d2
    part of Fab Kau cold agglutinin IgM

Details for d1dn0a1

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin
PDB Compounds: (A:) igm-kappa cold agglutinin (light chain)

SCOPe Domain Sequences for d1dn0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn0a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkvei

SCOPe Domain Coordinates for d1dn0a1:

Click to download the PDB-style file with coordinates for d1dn0a1.
(The format of our PDB-style files is described here.)

Timeline for d1dn0a1: