Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d4kxzi2: 4kxz I:108-213 [262883] Other proteins in same PDB: d4kxza_, d4kxzb_, d4kxzd_, d4kxze_, d4kxzi1, d4kxzl1, d4kxzm1, d4kxzp1 automated match to d1dn0a2 complexed with mes, pe5 |
PDB Entry: 4kxz (more details), 2.83 Å
SCOPe Domain Sequences for d4kxzi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kxzi2 b.1.1.2 (I:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d4kxzi2: