![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [259363] (2 PDB entries) |
![]() | Domain d4m85b1: 4m85 B:1-182 [259668] Other proteins in same PDB: d4m85a2, d4m85b2, d4m85c2, d4m85d2 automated match to d1u6ma_ |
PDB Entry: 4m85 (more details), 2 Å
SCOPe Domain Sequences for d4m85b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m85b1 d.108.1.0 (B:1-182) automated matches {Staphylococcus aureus [TaxId: 158878]} mirqarpedrfdiaklvymvwddmelelvkhlpkdmvldaiekscvdatyrtfyqhilvy evenkvagciisysgenelkyekawelldlpeeikqygtplpvkeakddeyyietiatfa ayrgrgiatklltsllesnthvkwslncdinneaalklykkvgfisdgqielykhmyhhl iv
Timeline for d4m85b1: