SCOPe 2.04: Domain d4m85b_: 4m85 B:

Lineage for d4m85b_ (4m85 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (28 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [259363] (2 PDB entries)

8. Domain d4m85b_: 4m85 B: [259668]
   automated match to d1u6ma_

Details for d4m85b_

PDB Entry: 4m85, 2 Å

PDB Description: crystal structure of n-acetyltransferase from staphylococcus aureus mu50

PDB Compounds: (B:) n-acetyltransferase

SCOPe Domain Sequences for d4m85b_:

Sequence; same for both SEQRES and ATOM records:

>d4m85b_ d.108.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
namirqarpedrfdiaklvymvwddmelelvkhlpkdmvldaiekscvdatyrtfyqhil
vyevenkvagciisysgenelkyekawelldlpeeikqygtplpvkeakddeyyietiat
faayrgrgiatklltsllesnthvkwslncdinneaalklykkvgfisdgqielykhmyh
hliv

Timeline for d4m85b_:

• d4m85b_ is new in SCOPe 2.04-stable
  
• d4m85b_ appears in SCOPe 2.05
  
• d4m85b_ appears in the current release, SCOPe 2.08, called d4m85b1