SCOPe 2.07: Domain d4cz7c1: 4cz7 C:302-331

Lineage for d4cz7c1 (4cz7 C:302-331)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
   core: 4 helices; bundle

4. Superfamily a.53.1: p53 tetramerization domain [47719] (2 families)
   homotetramer

5. Family a.53.1.0: automated matches [259188] (1 protein)
   not a true family

6. Protein automated matches [259190] (2 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries)

8. Domain d4cz7c1: 4cz7 C:302-331 [259651]
   Other proteins in same PDB: d4cz7b2, d4cz7c2, d4cz7d2, d4cz7e2, d4cz7f2
   automated match to d3saka_
   complexed with gol, po4

Details for d4cz7c1

PDB Entry: 4cz7, 1.1 Å

PDB Description: truncated tetramerization domain of zebrafish p53 (crystal form iii)

PDB Compounds: (C:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4cz7c1:

Sequence; same for both SEQRES and ATOM records:

>d4cz7c1 a.53.1.0 (C:302-331) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
eeiftlqvrgreryeilkklndslelsdvv

Timeline for d4cz7c1:

• d4cz7c1 first appeared in SCOPe 2.04, called d4cz7c_
  
• d4cz7c1 appears in SCOPe 2.06
  
• d4cz7c1 appears in the current release, SCOPe 2.08