Lineage for d4cz7d1 (4cz7 D:302-331)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328122Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2328123Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2328184Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 2328185Protein automated matches [259190] (2 species)
    not a true protein
  7. 2328230Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries)
  8. 2328238Domain d4cz7d1: 4cz7 D:302-331 [262674]
    Other proteins in same PDB: d4cz7b2, d4cz7c2, d4cz7d2, d4cz7e2, d4cz7f2
    automated match to d4cz7b_
    complexed with gol, po4

Details for d4cz7d1

PDB Entry: 4cz7 (more details), 1.1 Å

PDB Description: truncated tetramerization domain of zebrafish p53 (crystal form iii)
PDB Compounds: (D:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4cz7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cz7d1 a.53.1.0 (D:302-331) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
eeiftlqvrgreryeilkklndslelsdvv

SCOPe Domain Coordinates for d4cz7d1:

Click to download the PDB-style file with coordinates for d4cz7d1.
(The format of our PDB-style files is described here.)

Timeline for d4cz7d1: