Lineage for d4cz7c_ (4cz7 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493085Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 1493086Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 1493136Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 1493137Protein automated matches [259190] (1 species)
    not a true protein
  7. 1493138Species Danio rerio [TaxId:7955] [259192] (2 PDB entries)
  8. 1493141Domain d4cz7c_: 4cz7 C: [259651]
    automated match to d3saka_
    complexed with gol, po4

Details for d4cz7c_

PDB Entry: 4cz7 (more details), 1.1 Å

PDB Description: truncated tetramerization domain of zebrafish p53 (crystal form iii)
PDB Compounds: (C:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4cz7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cz7c_ a.53.1.0 (C:) automated matches {Danio rerio [TaxId: 7955]}
seeiftlqvrgreryeilkklndslelsdvv

SCOPe Domain Coordinates for d4cz7c_:

Click to download the PDB-style file with coordinates for d4cz7c_.
(The format of our PDB-style files is described here.)

Timeline for d4cz7c_:

  • d4cz7c_ appears in periodic updates to SCOPe 2.04 starting on 2014-09-19
  • d4cz7c_ appears in SCOPe 2.05
  • d4cz7c_ appears in the current release, SCOPe 2.07, called d4cz7c1