SCOPe 2.08: Domain d4qe1a_: 4qe1 A:

Lineage for d4qe1a_ (4qe1 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.3: Xylose isomerase [51665] (2 proteins)

6. Protein D-xylose isomerase [51666] (13 species)

7. Species Streptomyces rubiginosus [TaxId:1929] [51670] (89 PDB entries)

8. Domain d4qe1a_: 4qe1 A: [259488]
   automated match to d1mnza_
   complexed with cd, ruu

Details for d4qe1a_

PDB Entry: 4qe1, 1.55 Å

PDB Description: room temperature x-ray structure of d-xylose isomerase in complex with two cd2+ ions and l-ribulose

PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d4qe1a_:

Sequence; same for both SEQRES and ATOM records:

>d4qe1a_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgarg

Timeline for d4qe1a_:

• d4qe1a_ first appeared in SCOPe 2.04
  
• d4qe1a_ appears in SCOPe 2.07