| Class b: All beta proteins [48724] (180 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
| Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
| Species Escherichia coli [TaxId:562] [50468] (9 PDB entries) Uniprot P02990 |
| Domain d4q7jb3: 4q7j B:297-393 [259277] Other proteins in same PDB: d4q7ja1, d4q7ja2, d4q7ja3, d4q7jb1, d4q7jb2, d4q7je1, d4q7je2, d4q7je3, d4q7jf1, d4q7jf2 automated match to d1d8ta2 protein/RNA complex; complexed with so4 |
PDB Entry: 4q7j (more details), 2.9 Å
SCOPe Domain Sequences for d4q7jb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q7jb3 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg
Timeline for d4q7jb3: